PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00698_0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 190aa    MW: 21160.8 Da    PI: 9.1953
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00698_0010genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.1e-1482126348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       W   Ed +lv++v+++G+ +Wk  a++++ gRt+ qc++rw+++l
    kfl00698_0010  82 MWNSTEDSILVKLVQEFGPTRWKEKAERIP-GRTARQCRERWHNHL 126
                      6*****************************.*************97 PP

2Myb_DNA-binding47.25.2e-15132174145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g+W++eE   l+ +  qlG++ W++Ia++++ gR+++ +k++w+
    kfl00698_0010 132 KGPWSEEEKVTLAVLYSQLGPK-WSLIAKYLP-GRSDNCVKNHWY 174
                      79******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.2E-779128IPR001005SANT/Myb domain
SuperFamilySSF466896.79E-2780177IPR009057Homeodomain-like
PROSITE profilePS5129412.77680126IPR017930Myb domain
CDDcd001677.06E-1383126No hitNo description
PfamPF139212.9E-1483140No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2283133IPR009057Homeodomain-like
PROSITE profilePS5129419.013127181IPR017930Myb domain
SMARTSM007171.7E-11131179IPR001005SANT/Myb domain
CDDcd001675.21E-9134174No hitNo description
Gene3DG3DSA:1.10.10.601.1E-18134180IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MAEEGINAFG GRSSAPWSPD LLLAGATLPP LVSTSHPSFS TFSSASVQTL STETDGGYPD  60
AEDLGRESPT ALRLTGKPWR RMWNSTEDSI LVKLVQEFGP TRWKEKAERI PGRTARQCRE  120
RWHNHLEHNL NKGPWSEEEK VTLAVLYSQL GPKWSLIAKY LPGRSDNCVK NHWYAAVKRK  180
TGGGLCQQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-30831817105C-Myb DNA-Binding Domain
1msf_C3e-30831817105C-Myb DNA-Binding Domain
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.21e-31Homeodomain-like protein